PlannedSuppliesMarktconsultatie
Customer and employee satisfaction system
Gemeenschappelijke Regeling Sociaal · Marktconsultatie · 1 lots · 407735
4
4 of 6 core insights found
Measures presence, not accuracy · documents remain authoritative
ScopeAdvicePoints of attentionSuitability requirementsAward criteriaTimeline
Type
Supplies
48000000 · Software and informati
Estimated value
Not published
To deadline
Ongoing
Knock-outs
n/a
exclusion grounds
Award basis
Best price-quality ratio
Assess manuallyconfidence moderate
This market exploration focuses on mapping available solutions for a system to measure customer and employee satisfaction at the Sociale Dienst Drechtsteden.
Supplies · Marktconsultatie · National procedure
Complete timeline
CharacteristicsCPV 48SuppliesCustomer satisfactionEmployee satisfactionSoftware
01What is being requested
The assignment concerns the delivery of a customer and employee satisfaction system for the Sociale Dienst Drechtsteden to measure and analyze the experiences of residents and employees.
As Sociale Dienst Drechtsteden, we are looking for a system to measure the customer satisfaction of our clients after they have visited us or otherwise used our services or come into contact with us. Potentially, we also want to use the system to measure employee satisfaction.
1Customer and employee satisfaction system—
02Strategic insight
Strategic insight · AI analysis
When responding, focus on the integration with Power BI and the possibilities for AI-supported analysis. Ensure that the workflow module and automation of surveys are clearly explained. Emphasize experience with similar social services or municipalities.
03Points of attention
Important · 4
Participation in the market exploration is voluntary and non-binding.Important
The provided data should be considered indicative.Important
The market exploration is not intended for a preselection of parties.Important
No compensation will be paid for participation in the exploration.Important
04Process & timeline
Publication on TenderNed
9-1-2026
Deadline for submitting questions regarding the market exploration documents
22-1-2026 om 17 uur
Response to question round
30-1-2026
Deadline for written response
6-2-2026 om 17 uur
Further discussions
Nader te plannen
05Value in context
Estimate not published
The contracting authority did not publish an estimated value — common for a large share of contracts. The EU threshold for leveringen is € 221.000, for reference.
06Likely competitors
#Likely bidderFitWins
1Afas Software B.V.SME10081×
2Visma Raet B.V.SME9922×
3PinkRoccade Local Government B.V.SME9838×
4Visma Circle B.V.SME9823×
5Bechtle direct B.V.SME9833×
6COMPAREX Nederland B.V.SME9742×
07Tender documents
Bijlage A - Marktverkenningsvragen Klant- & medewerkerstevredenheidsysteemdocxJan 23, 2026 · 63 KB
TN566003 - EFE1 Vrijwillige aankondiging van voorafgaande marktconsultatie 20260109170026pdfJan 9, 2026 · 136 KB
Bijlage A - Marktverkenningsvragen Klant- & medewerkerstevredenheidsysteempdfJan 9, 2026 · 265 KB
250199GRS Marktverkenningsleidraad Klant- & medewerkerstevredenheidsysteempdfJan 9, 2026 · 453 KB
08Legal themes that may be relevant here
Advies 300> Openbare Europese aanbesteding voor beheer en onderhoud van applicaties en aanverwante ICT-diensten. De zittende leverancier heeComplaint upheldAdvies 689> Aanbesteder heeft vrijwillig bekendgemaakt dat hij een opdracht heeft gegund voor de inkoop van een softwareplatform voor gemeenComplaint upheldAdvies 440> Meervoudig onderhandse aanbestedingsprocedure voor een (concessie)opdracht voor diensten voor het beschikbaar stellen, plaatsen,Advies 598> De klacht ziet op een Europese openbare procedure voor een raamovereenkomst met één ondernemer voor diensten voor het op landeliComplaint dismissedAdvies 602> De klacht betreft een Europese niet-openbare procedure voor een overheidsopdracht voor architectendiensten ten behoeve van de ni
09Frequently asked questions
What is the purpose of the sought system?
The system is intended to measure the customer satisfaction of clients after they have visited or made use of the services. Additionally, there is the intention to potentially use the system for measuring employee satisfaction.
Which aspects of management and implementation are being investigated?
The required capacity for implementation and management is being examined, as well as the supplier's activities (such as maintenance, updates, and support), the time required to set up a survey, and how peak loads are managed.
How is the safeguarding of privacy and legislation ensured?
It is being investigated how the supplier deals with changes in laws and regulations, such as the GDPR and privacy, and to what extent the organization is set up to handle these matters specifically within the social domain.
What requirements are being set regarding digital sustainability?
It is being investigated how the platform contributes to digital sustainability, for example through energy consumption and cloud optimization. The future-proofing of the system and the handling of end-of-life and data migration are also points of attention.
What support is expected from the supplier?
The support model is being examined, including the helpdesk, SLA, and response times. In addition, attention is given to the possibility of training and onboarding for internal users.
Automatically compiled from the official tender data and documents.
10Estimated value versus the market
p25
€ 350K
€ 350K
median
€ 737K
€ 737K
p75
€ 1,9 mln
€ 1,9 mln
deze opdracht
Gegunde waarden in CPV 48 · leveringen n=653